Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 8,845
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,771
  3. Avatar for :) 13. :) 1 pt. 8,672
  4. Avatar for xkcd 14. xkcd 1 pt. 8,667
  5. Avatar for Russian team 15. Russian team 1 pt. 8,630
  6. Avatar for Deleted group 16. Deleted group pts. 8,266
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,110
  8. Avatar for freefolder 18. freefolder 1 pt. 7,966

  1. Avatar for ralan-nsk 91. ralan-nsk Lv 1 2 pts. 8,630
  2. Avatar for tokens 92. tokens Lv 1 2 pts. 8,608
  3. Avatar for Deleted player 93. Deleted player pts. 8,608
  4. Avatar for fishercat 94. fishercat Lv 1 1 pt. 8,606
  5. Avatar for spritz1992 95. spritz1992 Lv 1 1 pt. 8,585
  6. Avatar for molleke 96. molleke Lv 1 1 pt. 8,584
  7. Avatar for jausmh 97. jausmh Lv 1 1 pt. 8,578
  8. Avatar for martinf 98. martinf Lv 1 1 pt. 8,573
  9. Avatar for benrh 99. benrh Lv 1 1 pt. 8,571
  10. Avatar for DScott 100. DScott Lv 1 1 pt. 8,564

Comments