Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 9,027
  2. Avatar for Contenders 2. Contenders 74 pts. 9,022
  3. Avatar for Go Science 3. Go Science 54 pts. 9,014
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,014
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,001
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,992
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 8,966
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 8,962
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 8,929
  10. Avatar for Marvin's bunch 10. Marvin's bunch 3 pts. 8,894
  1. Avatar for ralan-nsk 91. ralan-nsk Lv 1 2 pts. 8,630
  2. Avatar for tokens 92. tokens Lv 1 2 pts. 8,608
  3. Avatar for Deleted player 93. Deleted player pts. 8,608
  4. Avatar for fishercat 94. fishercat Lv 1 1 pt. 8,606
  5. Avatar for spritz1992 95. spritz1992 Lv 1 1 pt. 8,585
  6. Avatar for molleke 96. molleke Lv 1 1 pt. 8,584
  7. Avatar for jausmh 97. jausmh Lv 1 1 pt. 8,578
  8. Avatar for martinf 98. martinf Lv 1 1 pt. 8,573
  9. Avatar for benrh 99. benrh Lv 1 1 pt. 8,571
  10. Avatar for DScott 100. DScott Lv 1 1 pt. 8,564

Comments