Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 8,845
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,771
  3. Avatar for :) 13. :) 1 pt. 8,672
  4. Avatar for xkcd 14. xkcd 1 pt. 8,667
  5. Avatar for Russian team 15. Russian team 1 pt. 8,630
  6. Avatar for Deleted group 16. Deleted group pts. 8,266
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,110
  8. Avatar for freefolder 18. freefolder 1 pt. 7,966
  1. Avatar for trentis1 131. trentis1 Lv 1 1 pt. 8,173
  2. Avatar for px43 132. px43 Lv 1 1 pt. 8,172
  3. Avatar for Radeodem8 133. Radeodem8 Lv 1 1 pt. 8,161
  4. Avatar for glaciall 134. glaciall Lv 1 1 pt. 8,136
  5. Avatar for IjtsiRamos 135. IjtsiRamos Lv 1 1 pt. 8,130
  6. Avatar for aspadistra 136. aspadistra Lv 1 1 pt. 8,110
  7. Avatar for leannerikicheever 137. leannerikicheever Lv 1 1 pt. 8,070
  8. Avatar for fujioyama 138. fujioyama Lv 1 1 pt. 8,059
  9. Avatar for pluto 139. pluto Lv 1 1 pt. 8,042
  10. Avatar for SNix 140. SNix Lv 1 1 pt. 8,038

Comments