Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 9,027
  2. Avatar for Contenders 2. Contenders 74 pts. 9,022
  3. Avatar for Go Science 3. Go Science 54 pts. 9,014
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,014
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,001
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,992
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 8,966
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 8,962
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 8,929
  10. Avatar for Marvin's bunch 10. Marvin's bunch 3 pts. 8,894
  1. Avatar for trentis1 131. trentis1 Lv 1 1 pt. 8,173
  2. Avatar for px43 132. px43 Lv 1 1 pt. 8,172
  3. Avatar for Radeodem8 133. Radeodem8 Lv 1 1 pt. 8,161
  4. Avatar for glaciall 134. glaciall Lv 1 1 pt. 8,136
  5. Avatar for IjtsiRamos 135. IjtsiRamos Lv 1 1 pt. 8,130
  6. Avatar for aspadistra 136. aspadistra Lv 1 1 pt. 8,110
  7. Avatar for leannerikicheever 137. leannerikicheever Lv 1 1 pt. 8,070
  8. Avatar for fujioyama 138. fujioyama Lv 1 1 pt. 8,059
  9. Avatar for pluto 139. pluto Lv 1 1 pt. 8,042
  10. Avatar for SNix 140. SNix Lv 1 1 pt. 8,038

Comments