Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 8,845
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,771
  3. Avatar for :) 13. :) 1 pt. 8,672
  4. Avatar for xkcd 14. xkcd 1 pt. 8,667
  5. Avatar for Russian team 15. Russian team 1 pt. 8,630
  6. Avatar for Deleted group 16. Deleted group pts. 8,266
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,110
  8. Avatar for freefolder 18. freefolder 1 pt. 7,966
  1. Avatar for Glen B 81. Glen B Lv 1 3 pts. 8,697
  2. Avatar for jebbiek 82. jebbiek Lv 1 3 pts. 8,696
  3. Avatar for demeter900 83. demeter900 Lv 1 3 pts. 8,695
  4. Avatar for Crossed Sticks 84. Crossed Sticks Lv 1 3 pts. 8,692
  5. Avatar for roman madala 85. roman madala Lv 1 2 pts. 8,691
  6. Avatar for machinelves 86. machinelves Lv 1 2 pts. 8,672
  7. Avatar for bcre8tvv 87. bcre8tvv Lv 1 2 pts. 8,672
  8. Avatar for fryguy 88. fryguy Lv 1 2 pts. 8,667
  9. Avatar for TastyMunchies 89. TastyMunchies Lv 1 2 pts. 8,649
  10. Avatar for NinjaGreg 90. NinjaGreg Lv 1 2 pts. 8,641

Comments