Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 9,027
  2. Avatar for Contenders 2. Contenders 74 pts. 9,022
  3. Avatar for Go Science 3. Go Science 54 pts. 9,014
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,014
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,001
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,992
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 8,966
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 8,962
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 8,929
  10. Avatar for Marvin's bunch 10. Marvin's bunch 3 pts. 8,894
  1. Avatar for Glen B 81. Glen B Lv 1 3 pts. 8,697
  2. Avatar for jebbiek 82. jebbiek Lv 1 3 pts. 8,696
  3. Avatar for demeter900 83. demeter900 Lv 1 3 pts. 8,695
  4. Avatar for Crossed Sticks 84. Crossed Sticks Lv 1 3 pts. 8,692
  5. Avatar for roman madala 85. roman madala Lv 1 2 pts. 8,691
  6. Avatar for machinelves 86. machinelves Lv 1 2 pts. 8,672
  7. Avatar for bcre8tvv 87. bcre8tvv Lv 1 2 pts. 8,672
  8. Avatar for fryguy 88. fryguy Lv 1 2 pts. 8,667
  9. Avatar for TastyMunchies 89. TastyMunchies Lv 1 2 pts. 8,649
  10. Avatar for NinjaGreg 90. NinjaGreg Lv 1 2 pts. 8,641

Comments