Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 9,819
  2. Avatar for Wilm 2. Wilm Lv 1 97 pts. 9,803
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 94 pts. 9,775
  4. Avatar for Susume 4. Susume Lv 1 91 pts. 9,720
  5. Avatar for markm457 5. markm457 Lv 1 88 pts. 9,717
  6. Avatar for grogar7 6. grogar7 Lv 1 86 pts. 9,701
  7. Avatar for caglar 7. caglar Lv 1 83 pts. 9,691
  8. Avatar for tokens 8. tokens Lv 1 80 pts. 9,687
  9. Avatar for eusair 9. eusair Lv 1 77 pts. 9,681
  10. Avatar for actiasluna 10. actiasluna Lv 1 75 pts. 9,680

Comments