Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,819
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,727
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,680
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,663
  5. Avatar for Contenders 5. Contenders 22 pts. 9,599
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,556
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,445
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 9,389
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,285
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,115
  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 9,819
  2. Avatar for Wilm 2. Wilm Lv 1 97 pts. 9,803
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 94 pts. 9,775
  4. Avatar for Susume 4. Susume Lv 1 91 pts. 9,720
  5. Avatar for markm457 5. markm457 Lv 1 88 pts. 9,717
  6. Avatar for grogar7 6. grogar7 Lv 1 86 pts. 9,701
  7. Avatar for caglar 7. caglar Lv 1 83 pts. 9,691
  8. Avatar for tokens 8. tokens Lv 1 80 pts. 9,687
  9. Avatar for eusair 9. eusair Lv 1 77 pts. 9,681
  10. Avatar for actiasluna 10. actiasluna Lv 1 75 pts. 9,680

Comments