Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for toshiue
    1. toshiue Lv 1
    100 pts. 9,819
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 85 pts. 9,814
  3. Avatar for jeff101 3. jeff101 Lv 1 71 pts. 9,814
  4. Avatar for ZeroLeak7 4. ZeroLeak7 Lv 1 60 pts. 9,813
  5. Avatar for Hollinas 5. Hollinas Lv 1 49 pts. 9,811
  6. Avatar for Wilm 6. Wilm Lv 1 41 pts. 9,805
  7. Avatar for Anfinsen_slept_here 7. Anfinsen_slept_here Lv 1 33 pts. 9,803
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 27 pts. 9,762
  9. Avatar for ViJay7019 9. ViJay7019 Lv 1 22 pts. 9,730
  10. Avatar for Galaxie 10. Galaxie Lv 1 17 pts. 9,727

Comments