Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups


  1. Avatar for Go Science 100 pts. 9,819
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,727
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,680
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,663
  5. Avatar for Contenders 5. Contenders 22 pts. 9,599
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,556
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,445
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 9,389
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,285
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,115

  1. Avatar for lamoille 11. lamoille Lv 1 14 pts. 9,723
  2. Avatar for pauldunn 12. pauldunn Lv 1 11 pts. 9,692
  3. Avatar for eromana 13. eromana Lv 1 8 pts. 9,677
  4. Avatar for Skippysk8s 14. Skippysk8s Lv 1 6 pts. 9,677
  5. Avatar for grogar7 15. grogar7 Lv 1 5 pts. 9,672
  6. Avatar for alwen 16. alwen Lv 1 4 pts. 9,669
  7. Avatar for phi16 17. phi16 Lv 1 3 pts. 9,663
  8. Avatar for alcor29 18. alcor29 Lv 1 2 pts. 9,660
  9. Avatar for LociOiling 19. LociOiling Lv 1 2 pts. 9,656
  10. Avatar for smilingone 20. smilingone Lv 1 1 pt. 9,654

Comments