Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups


  1. Avatar for Go Science 100 pts. 9,819
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,727
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,680
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,663
  5. Avatar for Contenders 5. Contenders 22 pts. 9,599
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,556
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,445
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 9,389
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,285
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,115

  1. Avatar for reefyrob 21. reefyrob Lv 1 1 pt. 9,652
  2. Avatar for randomlil 22. randomlil Lv 1 1 pt. 9,640
  3. Avatar for actiasluna 23. actiasluna Lv 1 1 pt. 9,611
  4. Avatar for Blipperman 24. Blipperman Lv 1 1 pt. 9,603
  5. Avatar for gitwut 25. gitwut Lv 1 1 pt. 9,599
  6. Avatar for Bletchley Park 26. Bletchley Park Lv 1 1 pt. 9,596
  7. Avatar for mimi 27. mimi Lv 1 1 pt. 9,586
  8. Avatar for crpainter 28. crpainter Lv 1 1 pt. 9,471
  9. Avatar for georg137 29. georg137 Lv 1 1 pt. 9,471
  10. Avatar for spvincent 30. spvincent Lv 1 1 pt. 9,456

Comments