Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Overall Overall Overall Prediction Prediction Prediction

Summary


Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups


  1. Avatar for Go Science 100 pts. 9,819
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,727
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,680
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,663
  5. Avatar for Contenders 5. Contenders 22 pts. 9,599
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,556
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,445
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 9,389
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,285
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,115

  1. Avatar for ppp6 91. ppp6 Lv 1 2 pts. 8,597
  2. Avatar for abledbody 92. abledbody Lv 1 2 pts. 8,596
  3. Avatar for boondog 93. boondog Lv 1 2 pts. 8,589
  4. Avatar for Arne Heessels 94. Arne Heessels Lv 1 2 pts. 8,577
  5. Avatar for benrh 95. benrh Lv 1 2 pts. 8,562
  6. Avatar for Hiro Protagonist 96. Hiro Protagonist Lv 1 1 pt. 8,550
  7. Avatar for Astray 97. Astray Lv 1 1 pt. 8,548
  8. Avatar for momadoc 98. momadoc Lv 1 1 pt. 8,475
  9. Avatar for YGK 99. YGK Lv 1 1 pt. 8,473
  10. Avatar for FractalCuber 100. FractalCuber Lv 1 1 pt. 8,460

Comments