Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Overall Overall Overall Prediction Prediction Prediction

Summary


Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups


  1. Avatar for Go Science 100 pts. 9,819
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,727
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,680
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,663
  5. Avatar for Contenders 5. Contenders 22 pts. 9,599
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,556
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,445
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 9,389
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,285
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,115

  1. Avatar for NotJim99 111. NotJim99 Lv 1 1 pt. 8,062
  2. Avatar for Erica_W 112. Erica_W Lv 1 1 pt. 8,002
  3. Avatar for ExecrabLe 113. ExecrabLe Lv 1 1 pt. 7,908
  4. Avatar for Vincera 114. Vincera Lv 1 1 pt. 7,891
  5. Avatar for Jspirit 115. Jspirit Lv 1 1 pt. 7,876
  6. Avatar for FoldinCaulfield 116. FoldinCaulfield Lv 1 1 pt. 7,678
  7. Avatar for ResetVirus 117. ResetVirus Lv 1 1 pt. 7,629
  8. Avatar for chemtox 118. chemtox Lv 1 1 pt. 7,585
  9. Avatar for rinze 119. rinze Lv 1 1 pt. 7,546
  10. Avatar for lamoille 120. lamoille Lv 1 1 pt. 7,535

Comments