Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups


  1. Avatar for Go Science 100 pts. 9,819
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,727
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,680
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,663
  5. Avatar for Contenders 5. Contenders 22 pts. 9,599
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,556
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,445
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 9,389
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,285
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,115

  1. Avatar for johnmitch 11. johnmitch Lv 1 72 pts. 9,677
  2. Avatar for bertro 12. bertro Lv 1 70 pts. 9,663
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 68 pts. 9,629
  4. Avatar for Galaxie 14. Galaxie Lv 1 65 pts. 9,597
  5. Avatar for mimi 15. mimi Lv 1 63 pts. 9,596
  6. Avatar for fiendish_ghoul 16. fiendish_ghoul Lv 1 61 pts. 9,585
  7. Avatar for Enzyme 17. Enzyme Lv 1 59 pts. 9,580
  8. Avatar for LociOiling 18. LociOiling Lv 1 57 pts. 9,577
  9. Avatar for gitwut 19. gitwut Lv 1 55 pts. 9,576
  10. Avatar for Skippysk8s 20. Skippysk8s Lv 1 53 pts. 9,568

Comments