Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups


  1. Avatar for Go Science 100 pts. 9,819
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,727
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,680
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,663
  5. Avatar for Contenders 5. Contenders 22 pts. 9,599
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,556
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,445
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 9,389
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,285
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,115

  1. Avatar for spvincent 21. spvincent Lv 1 51 pts. 9,564
  2. Avatar for Timo van der Laan 22. Timo van der Laan Lv 1 49 pts. 9,556
  3. Avatar for anthion 23. anthion Lv 1 48 pts. 9,553
  4. Avatar for Blipperman 24. Blipperman Lv 1 46 pts. 9,548
  5. Avatar for isaksson 25. isaksson Lv 1 44 pts. 9,517
  6. Avatar for smilingone 26. smilingone Lv 1 43 pts. 9,509
  7. Avatar for kabubi 27. kabubi Lv 1 41 pts. 9,506
  8. Avatar for YeshuaLives 28. YeshuaLives Lv 1 39 pts. 9,504
  9. Avatar for phi16 29. phi16 Lv 1 38 pts. 9,473
  10. Avatar for pauldunn 30. pauldunn Lv 1 37 pts. 9,461

Comments