Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups


  1. Avatar for Go Science 100 pts. 9,819
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,727
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,680
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,663
  5. Avatar for Contenders 5. Contenders 22 pts. 9,599
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,556
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,445
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 9,389
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,285
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,115

  1. Avatar for crpainter 31. crpainter Lv 1 35 pts. 9,459
  2. Avatar for christioanchauvin 32. christioanchauvin Lv 1 34 pts. 9,445
  3. Avatar for Vinara 33. Vinara Lv 1 32 pts. 9,443
  4. Avatar for guineapig 34. guineapig Lv 1 31 pts. 9,438
  5. Avatar for reefyrob 35. reefyrob Lv 1 30 pts. 9,424
  6. Avatar for lupussapien 36. lupussapien Lv 1 29 pts. 9,418
  7. Avatar for tarimo 37. tarimo Lv 1 28 pts. 9,414
  8. Avatar for Mike Cassidy 38. Mike Cassidy Lv 1 27 pts. 9,408
  9. Avatar for Anfinsen_slept_here 39. Anfinsen_slept_here Lv 1 26 pts. 9,406
  10. Avatar for dcrwheeler 40. dcrwheeler Lv 1 24 pts. 9,397

Comments