Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups


  1. Avatar for Go Science 100 pts. 9,819
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,727
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,680
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,663
  5. Avatar for Contenders 5. Contenders 22 pts. 9,599
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,556
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,445
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 9,389
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,285
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,115

  1. Avatar for dssb 61. dssb Lv 1 10 pts. 9,103
  2. Avatar for drumpeter18yrs9yrs 62. drumpeter18yrs9yrs Lv 1 9 pts. 9,092
  3. Avatar for diamonddays 63. diamonddays Lv 1 9 pts. 9,081
  4. Avatar for heather-1 64. heather-1 Lv 1 8 pts. 9,074
  5. Avatar for dizzywings 65. dizzywings Lv 1 8 pts. 9,000
  6. Avatar for molleke 66. molleke Lv 1 7 pts. 8,992
  7. Avatar for stomjoh 67. stomjoh Lv 1 7 pts. 8,981
  8. Avatar for TastyMunchies 68. TastyMunchies Lv 1 7 pts. 8,969
  9. Avatar for Superphosphate 69. Superphosphate Lv 1 6 pts. 8,943
  10. Avatar for machinelves 70. machinelves Lv 1 6 pts. 8,923

Comments