Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups


  1. Avatar for Go Science 100 pts. 9,819
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,727
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,680
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,663
  5. Avatar for Contenders 5. Contenders 22 pts. 9,599
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,556
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,445
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 9,389
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,285
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,115

  1. Avatar for ralan-nsk 71. ralan-nsk Lv 1 6 pts. 8,914
  2. Avatar for georg137 72. georg137 Lv 1 5 pts. 8,912
  3. Avatar for harvardman 73. harvardman Lv 1 5 pts. 8,890
  4. Avatar for Merf 74. Merf Lv 1 5 pts. 8,887
  5. Avatar for Deleted player 75. Deleted player pts. 8,884
  6. Avatar for Deleted player 76. Deleted player pts. 8,862
  7. Avatar for andrewxc 77. andrewxc Lv 1 4 pts. 8,857
  8. Avatar for deLaCeiba 78. deLaCeiba Lv 1 4 pts. 8,856
  9. Avatar for ZAxel91 79. ZAxel91 Lv 1 4 pts. 8,855
  10. Avatar for froggs554 80. froggs554 Lv 1 4 pts. 8,854

Comments