Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups


  1. Avatar for xkcd 11. xkcd 5 pts. 9,007
  2. Avatar for Deleted group 12. Deleted group pts. 8,921
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,827
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 2 pts. 8,718
  5. Avatar for GC Sommerlejr 2017 15. GC Sommerlejr 2017 1 pt. 8,663
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,412
  7. Avatar for Deleted group 17. Deleted group pts. 8,385
  8. Avatar for :) 18. :) 1 pt. 8,197
  9. Avatar for SETI.Germany 20. SETI.Germany 1 pt. 7,803

  1. Avatar for bcre8tvv 111. bcre8tvv Lv 1 1 pt. 8,334
  2. Avatar for ViJay7019 112. ViJay7019 Lv 1 1 pt. 8,322
  3. Avatar for Senexs 113. Senexs Lv 1 1 pt. 8,300
  4. Avatar for rabamino12358 114. rabamino12358 Lv 1 1 pt. 8,240
  5. Avatar for Deleted player 115. Deleted player pts. 8,236
  6. Avatar for machinelves 116. machinelves Lv 1 1 pt. 8,197
  7. Avatar for gadello 117. gadello Lv 1 1 pt. 8,178
  8. Avatar for Huday 118. Huday Lv 1 1 pt. 8,171
  9. Avatar for rinze 119. rinze Lv 1 1 pt. 8,167
  10. Avatar for Dantoto 120. Dantoto Lv 1 1 pt. 8,093

Comments