Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,685
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,656
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,572
  4. Avatar for Marvin's bunch 4. Marvin's bunch 49 pts. 9,465
  5. Avatar for Contenders 5. Contenders 37 pts. 9,464
  6. Avatar for Go Science 6. Go Science 28 pts. 9,463
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,293
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 9,278
  9. Avatar for Russian team 9. Russian team 11 pts. 9,104
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,022
  1. Avatar for bcre8tvv 111. bcre8tvv Lv 1 1 pt. 8,334
  2. Avatar for ViJay7019 112. ViJay7019 Lv 1 1 pt. 8,322
  3. Avatar for Senexs 113. Senexs Lv 1 1 pt. 8,300
  4. Avatar for rabamino12358 114. rabamino12358 Lv 1 1 pt. 8,240
  5. Avatar for Deleted player 115. Deleted player pts. 8,236
  6. Avatar for machinelves 116. machinelves Lv 1 1 pt. 8,197
  7. Avatar for gadello 117. gadello Lv 1 1 pt. 8,178
  8. Avatar for Huday 118. Huday Lv 1 1 pt. 8,171
  9. Avatar for rinze 119. rinze Lv 1 1 pt. 8,167
  10. Avatar for Dantoto 120. Dantoto Lv 1 1 pt. 8,093

Comments