Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,007
  2. Avatar for Deleted group 12. Deleted group pts. 8,921
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,827
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 2 pts. 8,718
  5. Avatar for GC Sommerlejr 2017 15. GC Sommerlejr 2017 1 pt. 8,663
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,412
  7. Avatar for Deleted group 17. Deleted group pts. 8,385
  8. Avatar for :) 18. :) 1 pt. 8,197
  9. Avatar for Boinformatics and biotechnology course 19. Boinformatics and biotechnology course 1 pt. 8,178
  10. Avatar for SETI.Germany 20. SETI.Germany 1 pt. 7,803
  1. Avatar for fujioyama 121. fujioyama Lv 1 1 pt. 7,968
  2. Avatar for Jspirit 122. Jspirit Lv 1 1 pt. 7,941
  3. Avatar for parsnip 123. parsnip Lv 1 1 pt. 7,931
  4. Avatar for Michele_H 124. Michele_H Lv 1 1 pt. 7,820
  5. Avatar for BuzzDee 125. BuzzDee Lv 1 1 pt. 7,803
  6. Avatar for NotJim99 126. NotJim99 Lv 1 1 pt. 7,795
  7. Avatar for MadCat08 127. MadCat08 Lv 1 1 pt. 7,745
  8. Avatar for tela 128. tela Lv 1 1 pt. 7,710
  9. Avatar for Caleb_Y 129. Caleb_Y Lv 1 1 pt. 7,677
  10. Avatar for DScott 130. DScott Lv 1 1 pt. 7,651

Comments