Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,685
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,656
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,572
  4. Avatar for Marvin's bunch 4. Marvin's bunch 49 pts. 9,465
  5. Avatar for Contenders 5. Contenders 37 pts. 9,464
  6. Avatar for Go Science 6. Go Science 28 pts. 9,463
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,293
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 9,278
  9. Avatar for Russian team 9. Russian team 11 pts. 9,104
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,022
  1. Avatar for fujioyama 121. fujioyama Lv 1 1 pt. 7,968
  2. Avatar for Jspirit 122. Jspirit Lv 1 1 pt. 7,941
  3. Avatar for parsnip 123. parsnip Lv 1 1 pt. 7,931
  4. Avatar for Michele_H 124. Michele_H Lv 1 1 pt. 7,820
  5. Avatar for BuzzDee 125. BuzzDee Lv 1 1 pt. 7,803
  6. Avatar for NotJim99 126. NotJim99 Lv 1 1 pt. 7,795
  7. Avatar for MadCat08 127. MadCat08 Lv 1 1 pt. 7,745
  8. Avatar for tela 128. tela Lv 1 1 pt. 7,710
  9. Avatar for Caleb_Y 129. Caleb_Y Lv 1 1 pt. 7,677
  10. Avatar for DScott 130. DScott Lv 1 1 pt. 7,651

Comments