Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,007
  2. Avatar for Deleted group 12. Deleted group pts. 8,921
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,827
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 2 pts. 8,718
  5. Avatar for GC Sommerlejr 2017 15. GC Sommerlejr 2017 1 pt. 8,663
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,412
  7. Avatar for Deleted group 17. Deleted group pts. 8,385
  8. Avatar for :) 18. :) 1 pt. 8,197
  9. Avatar for Boinformatics and biotechnology course 19. Boinformatics and biotechnology course 1 pt. 8,178
  10. Avatar for SETI.Germany 20. SETI.Germany 1 pt. 7,803
  1. Avatar for gmn 11. gmn Lv 1 75 pts. 9,497
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 73 pts. 9,487
  3. Avatar for gitwut 13. gitwut Lv 1 70 pts. 9,459
  4. Avatar for frood66 14. frood66 Lv 1 68 pts. 9,448
  5. Avatar for Bruno Kestemont 15. Bruno Kestemont Lv 1 66 pts. 9,447
  6. Avatar for eusair 16. eusair Lv 1 64 pts. 9,442
  7. Avatar for Enzyme 17. Enzyme Lv 1 62 pts. 9,436
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 60 pts. 9,433
  9. Avatar for LociOiling 19. LociOiling Lv 1 58 pts. 9,417
  10. Avatar for Wilm 20. Wilm Lv 1 57 pts. 9,410

Comments