Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,685
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,656
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,572
  4. Avatar for Marvin's bunch 4. Marvin's bunch 49 pts. 9,465
  5. Avatar for Contenders 5. Contenders 37 pts. 9,464
  6. Avatar for Go Science 6. Go Science 28 pts. 9,463
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,293
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 9,278
  9. Avatar for Russian team 9. Russian team 11 pts. 9,104
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,022
  1. Avatar for gmn 11. gmn Lv 1 75 pts. 9,497
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 73 pts. 9,487
  3. Avatar for gitwut 13. gitwut Lv 1 70 pts. 9,459
  4. Avatar for frood66 14. frood66 Lv 1 68 pts. 9,448
  5. Avatar for Bruno Kestemont 15. Bruno Kestemont Lv 1 66 pts. 9,447
  6. Avatar for eusair 16. eusair Lv 1 64 pts. 9,442
  7. Avatar for Enzyme 17. Enzyme Lv 1 62 pts. 9,436
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 60 pts. 9,433
  9. Avatar for LociOiling 19. LociOiling Lv 1 58 pts. 9,417
  10. Avatar for Wilm 20. Wilm Lv 1 57 pts. 9,410

Comments