Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups


  1. Avatar for xkcd 11. xkcd 5 pts. 9,007
  2. Avatar for Deleted group 12. Deleted group pts. 8,921
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,827
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 2 pts. 8,718
  5. Avatar for GC Sommerlejr 2017 15. GC Sommerlejr 2017 1 pt. 8,663
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,412
  7. Avatar for Deleted group 17. Deleted group pts. 8,385
  8. Avatar for :) 18. :) 1 pt. 8,197
  9. Avatar for SETI.Germany 20. SETI.Germany 1 pt. 7,803

  1. Avatar for fishercat 31. fishercat Lv 1 39 pts. 9,301
  2. Avatar for crpainter 32. crpainter Lv 1 38 pts. 9,301
  3. Avatar for smilingone 33. smilingone Lv 1 37 pts. 9,300
  4. Avatar for Anfinsen_slept_here 34. Anfinsen_slept_here Lv 1 35 pts. 9,296
  5. Avatar for kabubi 35. kabubi Lv 1 34 pts. 9,293
  6. Avatar for phi16 36. phi16 Lv 1 33 pts. 9,293
  7. Avatar for johnmitch 37. johnmitch Lv 1 32 pts. 9,292
  8. Avatar for Threeoak 38. Threeoak Lv 1 31 pts. 9,288
  9. Avatar for christioanchauvin 39. christioanchauvin Lv 1 30 pts. 9,278
  10. Avatar for nicobul 40. nicobul Lv 1 29 pts. 9,271

Comments