Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,685
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,656
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,572
  4. Avatar for Marvin's bunch 4. Marvin's bunch 49 pts. 9,465
  5. Avatar for Contenders 5. Contenders 37 pts. 9,464
  6. Avatar for Go Science 6. Go Science 28 pts. 9,463
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,293
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 9,278
  9. Avatar for Russian team 9. Russian team 11 pts. 9,104
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,022
  1. Avatar for fishercat 31. fishercat Lv 1 39 pts. 9,301
  2. Avatar for crpainter 32. crpainter Lv 1 38 pts. 9,301
  3. Avatar for smilingone 33. smilingone Lv 1 37 pts. 9,300
  4. Avatar for Anfinsen_slept_here 34. Anfinsen_slept_here Lv 1 35 pts. 9,296
  5. Avatar for kabubi 35. kabubi Lv 1 34 pts. 9,293
  6. Avatar for phi16 36. phi16 Lv 1 33 pts. 9,293
  7. Avatar for johnmitch 37. johnmitch Lv 1 32 pts. 9,292
  8. Avatar for Threeoak 38. Threeoak Lv 1 31 pts. 9,288
  9. Avatar for christioanchauvin 39. christioanchauvin Lv 1 30 pts. 9,278
  10. Avatar for nicobul 40. nicobul Lv 1 29 pts. 9,271

Comments