Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,007
  2. Avatar for Deleted group 12. Deleted group pts. 8,921
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,827
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 2 pts. 8,718
  5. Avatar for GC Sommerlejr 2017 15. GC Sommerlejr 2017 1 pt. 8,663
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,412
  7. Avatar for Deleted group 17. Deleted group pts. 8,385
  8. Avatar for :) 18. :) 1 pt. 8,197
  9. Avatar for Boinformatics and biotechnology course 19. Boinformatics and biotechnology course 1 pt. 8,178
  10. Avatar for SETI.Germany 20. SETI.Germany 1 pt. 7,803
  1. Avatar for WBarme1234 41. WBarme1234 Lv 1 28 pts. 9,260
  2. Avatar for jermainiac 42. jermainiac Lv 1 27 pts. 9,252
  3. Avatar for alwen 43. alwen Lv 1 26 pts. 9,241
  4. Avatar for lupussapien 44. lupussapien Lv 1 25 pts. 9,237
  5. Avatar for pvc78 45. pvc78 Lv 1 24 pts. 9,232
  6. Avatar for Timo van der Laan 46. Timo van der Laan Lv 1 23 pts. 9,227
  7. Avatar for heather-1 47. heather-1 Lv 1 22 pts. 9,207
  8. Avatar for spmm 48. spmm Lv 1 21 pts. 9,166
  9. Avatar for andrewtmaxwell 49. andrewtmaxwell Lv 1 20 pts. 9,156
  10. Avatar for pauldunn 50. pauldunn Lv 1 20 pts. 9,155

Comments