Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,685
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,656
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,572
  4. Avatar for Marvin's bunch 4. Marvin's bunch 49 pts. 9,465
  5. Avatar for Contenders 5. Contenders 37 pts. 9,464
  6. Avatar for Go Science 6. Go Science 28 pts. 9,463
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,293
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 9,278
  9. Avatar for Russian team 9. Russian team 11 pts. 9,104
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,022
  1. Avatar for WBarme1234 41. WBarme1234 Lv 1 28 pts. 9,260
  2. Avatar for jermainiac 42. jermainiac Lv 1 27 pts. 9,252
  3. Avatar for alwen 43. alwen Lv 1 26 pts. 9,241
  4. Avatar for lupussapien 44. lupussapien Lv 1 25 pts. 9,237
  5. Avatar for pvc78 45. pvc78 Lv 1 24 pts. 9,232
  6. Avatar for Timo van der Laan 46. Timo van der Laan Lv 1 23 pts. 9,227
  7. Avatar for heather-1 47. heather-1 Lv 1 22 pts. 9,207
  8. Avatar for spmm 48. spmm Lv 1 21 pts. 9,166
  9. Avatar for andrewtmaxwell 49. andrewtmaxwell Lv 1 20 pts. 9,156
  10. Avatar for pauldunn 50. pauldunn Lv 1 20 pts. 9,155

Comments