Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,007
  2. Avatar for Deleted group 12. Deleted group pts. 8,921
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,827
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 2 pts. 8,718
  5. Avatar for GC Sommerlejr 2017 15. GC Sommerlejr 2017 1 pt. 8,663
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,412
  7. Avatar for Deleted group 17. Deleted group pts. 8,385
  8. Avatar for :) 18. :) 1 pt. 8,197
  9. Avatar for Boinformatics and biotechnology course 19. Boinformatics and biotechnology course 1 pt. 8,178
  10. Avatar for SETI.Germany 20. SETI.Germany 1 pt. 7,803
  1. Avatar for jausmh 71. jausmh Lv 1 8 pts. 8,970
  2. Avatar for YeshuaLives 72. YeshuaLives Lv 1 8 pts. 8,951
  3. Avatar for uihcv 73. uihcv Lv 1 7 pts. 8,942
  4. Avatar for Deleted player 74. Deleted player pts. 8,938
  5. Avatar for LavenderSky 75. LavenderSky Lv 1 7 pts. 8,928
  6. Avatar for drumpeter18yrs9yrs 76. drumpeter18yrs9yrs Lv 1 6 pts. 8,921
  7. Avatar for SaraL 77. SaraL Lv 1 6 pts. 8,913
  8. Avatar for jobo0502 78. jobo0502 Lv 1 6 pts. 8,906
  9. Avatar for Deleted player 79. Deleted player 6 pts. 8,902
  10. Avatar for Vincera 80. Vincera Lv 1 5 pts. 8,901

Comments