Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,685
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,656
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,572
  4. Avatar for Marvin's bunch 4. Marvin's bunch 49 pts. 9,465
  5. Avatar for Contenders 5. Contenders 37 pts. 9,464
  6. Avatar for Go Science 6. Go Science 28 pts. 9,463
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,293
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 9,278
  9. Avatar for Russian team 9. Russian team 11 pts. 9,104
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,022
  1. Avatar for jausmh 71. jausmh Lv 1 8 pts. 8,970
  2. Avatar for YeshuaLives 72. YeshuaLives Lv 1 8 pts. 8,951
  3. Avatar for uihcv 73. uihcv Lv 1 7 pts. 8,942
  4. Avatar for Deleted player 74. Deleted player pts. 8,938
  5. Avatar for LavenderSky 75. LavenderSky Lv 1 7 pts. 8,928
  6. Avatar for drumpeter18yrs9yrs 76. drumpeter18yrs9yrs Lv 1 6 pts. 8,921
  7. Avatar for SaraL 77. SaraL Lv 1 6 pts. 8,913
  8. Avatar for jobo0502 78. jobo0502 Lv 1 6 pts. 8,906
  9. Avatar for Deleted player 79. Deleted player 6 pts. 8,902
  10. Avatar for Vincera 80. Vincera Lv 1 5 pts. 8,901

Comments