Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,007
  2. Avatar for Deleted group 12. Deleted group pts. 8,921
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,827
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 2 pts. 8,718
  5. Avatar for GC Sommerlejr 2017 15. GC Sommerlejr 2017 1 pt. 8,663
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,412
  7. Avatar for Deleted group 17. Deleted group pts. 8,385
  8. Avatar for :) 18. :) 1 pt. 8,197
  9. Avatar for Boinformatics and biotechnology course 19. Boinformatics and biotechnology course 1 pt. 8,178
  10. Avatar for SETI.Germany 20. SETI.Germany 1 pt. 7,803
  1. Avatar for SKSbell 81. SKSbell Lv 1 5 pts. 8,883
  2. Avatar for benrh 82. benrh Lv 1 5 pts. 8,869
  3. Avatar for jamiexq 83. jamiexq Lv 1 5 pts. 8,869
  4. Avatar for alcor29 84. alcor29 Lv 1 4 pts. 8,836
  5. Avatar for Mr_Jolty 85. Mr_Jolty Lv 1 4 pts. 8,827
  6. Avatar for fpc 86. fpc Lv 1 4 pts. 8,808
  7. Avatar for dl2007 87. dl2007 Lv 1 4 pts. 8,784
  8. Avatar for carsonfb 88. carsonfb Lv 1 4 pts. 8,776
  9. Avatar for Reldas 89. Reldas Lv 1 3 pts. 8,760
  10. Avatar for Savas 90. Savas Lv 1 3 pts. 8,718

Comments