Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,685
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,656
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,572
  4. Avatar for Marvin's bunch 4. Marvin's bunch 49 pts. 9,465
  5. Avatar for Contenders 5. Contenders 37 pts. 9,464
  6. Avatar for Go Science 6. Go Science 28 pts. 9,463
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,293
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 9,278
  9. Avatar for Russian team 9. Russian team 11 pts. 9,104
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,022
  1. Avatar for SKSbell 81. SKSbell Lv 1 5 pts. 8,883
  2. Avatar for benrh 82. benrh Lv 1 5 pts. 8,869
  3. Avatar for jamiexq 83. jamiexq Lv 1 5 pts. 8,869
  4. Avatar for alcor29 84. alcor29 Lv 1 4 pts. 8,836
  5. Avatar for Mr_Jolty 85. Mr_Jolty Lv 1 4 pts. 8,827
  6. Avatar for fpc 86. fpc Lv 1 4 pts. 8,808
  7. Avatar for dl2007 87. dl2007 Lv 1 4 pts. 8,784
  8. Avatar for carsonfb 88. carsonfb Lv 1 4 pts. 8,776
  9. Avatar for Reldas 89. Reldas Lv 1 3 pts. 8,760
  10. Avatar for Savas 90. Savas Lv 1 3 pts. 8,718

Comments