Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,648
  2. Avatar for Kotocycle 22. Kotocycle 1 pt. 0
  3. Avatar for DNA Masters 23. DNA Masters 1 pt. 0
  1. Avatar for toshiue 91. toshiue Lv 1 3 pts. 8,708
  2. Avatar for dbuske 92. dbuske Lv 1 3 pts. 8,708
  3. Avatar for mitarcher 93. mitarcher Lv 1 3 pts. 8,671
  4. Avatar for ZAxel91 94. ZAxel91 Lv 1 3 pts. 8,666
  5. Avatar for DrCompchem 95. DrCompchem Lv 1 3 pts. 8,663
  6. Avatar for ppp6 96. ppp6 Lv 1 2 pts. 8,651
  7. Avatar for spritz1992 97. spritz1992 Lv 1 2 pts. 8,639
  8. Avatar for Anton Trikshev 98. Anton Trikshev Lv 1 2 pts. 8,629
  9. Avatar for Arne Heessels 99. Arne Heessels Lv 1 2 pts. 8,626
  10. Avatar for Superphosphate 100. Superphosphate Lv 1 2 pts. 8,619

Comments