Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,648
  2. Avatar for Kotocycle 22. Kotocycle 1 pt. 0
  3. Avatar for DNA Masters 23. DNA Masters 1 pt. 0
  1. Avatar for Ciruxia 141. Ciruxia Lv 1 1 pt. 7,406
  2. Avatar for zxlitening 142. zxlitening Lv 1 1 pt. 7,336
  3. Avatar for nemesis21 143. nemesis21 Lv 1 1 pt. 7,153
  4. Avatar for andrewxc 144. andrewxc Lv 1 1 pt. 6,825
  5. Avatar for FoolontheHill24 145. FoolontheHill24 Lv 1 1 pt. 6,820
  6. Avatar for Mackenzie_BestL 146. Mackenzie_BestL Lv 1 1 pt. 6,764
  7. Avatar for Biomolecularchemist_Danny9292 147. Biomolecularchemist_Danny9292 Lv 1 1 pt. 6,668
  8. Avatar for lamoille 148. lamoille Lv 1 1 pt. 6,557
  9. Avatar for Fog Darts 149. Fog Darts Lv 1 1 pt. 6,376
  10. Avatar for pandapharmd 150. pandapharmd Lv 1 1 pt. 5,994

Comments