Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,648
  2. Avatar for Kotocycle 22. Kotocycle 1 pt. 0
  3. Avatar for DNA Masters 23. DNA Masters 1 pt. 0
  1. Avatar for shuuji517 161. shuuji517 Lv 1 1 pt. 268
  2. Avatar for Tehnologik1 162. Tehnologik1 Lv 1 1 pt. 0
  3. Avatar for metafolder 163. metafolder Lv 1 1 pt. 0
  4. Avatar for brucederby 164. brucederby Lv 1 1 pt. 0
  5. Avatar for Vincenzo Brancaccio 165. Vincenzo Brancaccio Lv 1 1 pt. 0
  6. Avatar for Ikuso 166. Ikuso Lv 1 1 pt. 0
  7. Avatar for hpaege 167. hpaege Lv 1 1 pt. 0
  8. Avatar for tony46 168. tony46 Lv 1 1 pt. 0
  9. Avatar for einstien123 169. einstien123 Lv 1 1 pt. 0
  10. Avatar for Avi.kawa 170. Avi.kawa Lv 1 1 pt. 0

Comments