Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,648
  2. Avatar for Kotocycle 22. Kotocycle 1 pt. 0
  3. Avatar for DNA Masters 23. DNA Masters 1 pt. 0
  1. Avatar for Blipperman 51. Blipperman Lv 1 19 pts. 9,139
  2. Avatar for SWR_DMaster 52. SWR_DMaster Lv 1 18 pts. 9,134
  3. Avatar for tarimo 53. tarimo Lv 1 17 pts. 9,120
  4. Avatar for guineapig 54. guineapig Lv 1 17 pts. 9,105
  5. Avatar for ralan-nsk 55. ralan-nsk Lv 1 16 pts. 9,104
  6. Avatar for isaksson 56. isaksson Lv 1 15 pts. 9,100
  7. Avatar for katling 57. katling Lv 1 15 pts. 9,080
  8. Avatar for Mike Cassidy 58. Mike Cassidy Lv 1 14 pts. 9,070
  9. Avatar for Glen B 59. Glen B Lv 1 14 pts. 9,053
  10. Avatar for harvardman 60. harvardman Lv 1 13 pts. 9,051

Comments