Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,648
  2. Avatar for Kotocycle 22. Kotocycle 1 pt. 0
  3. Avatar for DNA Masters 23. DNA Masters 1 pt. 0
  1. Avatar for randomlil 61. randomlil Lv 1 13 pts. 9,050
  2. Avatar for georg137 62. georg137 Lv 1 12 pts. 9,034
  3. Avatar for diamonddays 63. diamonddays Lv 1 12 pts. 9,033
  4. Avatar for manu8170 64. manu8170 Lv 1 11 pts. 9,028
  5. Avatar for deLaCeiba 65. deLaCeiba Lv 1 11 pts. 9,022
  6. Avatar for dizzywings 66. dizzywings Lv 1 10 pts. 9,019
  7. Avatar for fryguy 67. fryguy Lv 1 10 pts. 9,007
  8. Avatar for Merf 68. Merf Lv 1 9 pts. 9,004
  9. Avatar for stomjoh 69. stomjoh Lv 1 9 pts. 8,997
  10. Avatar for dssb 70. dssb Lv 1 9 pts. 8,987

Comments