Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,465
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,171
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,140
  4. Avatar for xkcd 14. xkcd 1 pt. 8,924
  5. Avatar for Russian team 15. Russian team 1 pt. 8,766
  6. Avatar for :) 16. :) 1 pt. 8,723
  7. Avatar for GC Sommerlejr 2017 17. GC Sommerlejr 2017 1 pt. 8,346
  8. Avatar for Deleted group 18. Deleted group pts. 7,808
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 7,532
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 7,256
  1. Avatar for harvardman 101. harvardman Lv 1 2 pts. 8,725
  2. Avatar for machinelves 102. machinelves Lv 1 2 pts. 8,723
  3. Avatar for cbwest 103. cbwest Lv 1 2 pts. 8,717
  4. Avatar for Squirrely 104. Squirrely Lv 1 2 pts. 8,713
  5. Avatar for Vincera 105. Vincera Lv 1 2 pts. 8,602
  6. Avatar for weby007 106. weby007 Lv 1 1 pt. 8,577
  7. Avatar for Deleted player 107. Deleted player 1 pt. 8,561
  8. Avatar for SKSbell 108. SKSbell Lv 1 1 pt. 8,549
  9. Avatar for LavenderSky 109. LavenderSky Lv 1 1 pt. 8,523
  10. Avatar for rabamino12358 110. rabamino12358 Lv 1 1 pt. 8,521

Comments