Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Contenders 100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 78 pts. 9,993
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,964
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,947
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,936
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 9,936
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,804
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,788
  9. Avatar for Kotocycle 9. Kotocycle 8 pts. 9,694
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,596

  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 9,969
  2. Avatar for LociOiling 2. LociOiling Lv 1 98 pts. 9,964
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 95 pts. 9,958
  4. Avatar for matosfran 4. matosfran Lv 1 92 pts. 9,953
  5. Avatar for actiasluna 5. actiasluna Lv 1 89 pts. 9,947
  6. Avatar for Skippysk8s 6. Skippysk8s Lv 1 87 pts. 9,939
  7. Avatar for frood66 7. frood66 Lv 1 84 pts. 9,936
  8. Avatar for markm457 8. markm457 Lv 1 82 pts. 9,930
  9. Avatar for mimi 9. mimi Lv 1 79 pts. 9,911
  10. Avatar for ZeroLeak7 10. ZeroLeak7 Lv 1 77 pts. 9,911

Comments