Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,465
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,171
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,140
  4. Avatar for xkcd 14. xkcd 1 pt. 8,924
  5. Avatar for Russian team 15. Russian team 1 pt. 8,766
  6. Avatar for :) 16. :) 1 pt. 8,723
  7. Avatar for GC Sommerlejr 2017 17. GC Sommerlejr 2017 1 pt. 8,346
  8. Avatar for Deleted group 18. Deleted group pts. 7,808
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 7,532
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 7,256
  1. Avatar for benrh 111. benrh Lv 1 1 pt. 8,498
  2. Avatar for hada 112. hada Lv 1 1 pt. 8,497
  3. Avatar for mitarcher 113. mitarcher Lv 1 1 pt. 8,477
  4. Avatar for senor pit 114. senor pit Lv 1 1 pt. 8,450
  5. Avatar for DScott 115. DScott Lv 1 1 pt. 8,360
  6. Avatar for DrCompchem 116. DrCompchem Lv 1 1 pt. 8,346
  7. Avatar for leehaggis 117. leehaggis Lv 1 1 pt. 8,343
  8. Avatar for molleke 118. molleke Lv 1 1 pt. 8,327
  9. Avatar for roman madala 119. roman madala Lv 1 1 pt. 8,319
  10. Avatar for khendarg 120. khendarg Lv 1 1 pt. 8,279

Comments