Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,465
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,171
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,140
  4. Avatar for xkcd 14. xkcd 1 pt. 8,924
  5. Avatar for Russian team 15. Russian team 1 pt. 8,766
  6. Avatar for :) 16. :) 1 pt. 8,723
  7. Avatar for GC Sommerlejr 2017 17. GC Sommerlejr 2017 1 pt. 8,346
  8. Avatar for Deleted group 18. Deleted group pts. 7,808
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 7,532
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 7,256
  1. Avatar for DoctorSockrates 71. DoctorSockrates Lv 1 8 pts. 9,396
  2. Avatar for weitzen 72. weitzen Lv 1 8 pts. 9,357
  3. Avatar for Merf 73. Merf Lv 1 7 pts. 9,330
  4. Avatar for Superphosphate 74. Superphosphate Lv 1 7 pts. 9,327
  5. Avatar for spritz1992 75. spritz1992 Lv 1 7 pts. 9,323
  6. Avatar for alcor29 76. alcor29 Lv 1 6 pts. 9,316
  7. Avatar for dbuske 77. dbuske Lv 1 6 pts. 9,292
  8. Avatar for carsonfb 78. carsonfb Lv 1 6 pts. 9,272
  9. Avatar for ProHarTius 79. ProHarTius Lv 1 5 pts. 9,269
  10. Avatar for tokens 80. tokens Lv 1 5 pts. 9,258

Comments