Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,465
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,171
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,140
  4. Avatar for xkcd 14. xkcd 1 pt. 8,924
  5. Avatar for Russian team 15. Russian team 1 pt. 8,766
  6. Avatar for :) 16. :) 1 pt. 8,723
  7. Avatar for GC Sommerlejr 2017 17. GC Sommerlejr 2017 1 pt. 8,346
  8. Avatar for Deleted group 18. Deleted group pts. 7,808
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 7,532
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 7,256

  1. Avatar for pfirth 81. pfirth Lv 1 5 pts. 9,222
  2. Avatar for bcre8tvv 82. bcre8tvv Lv 1 5 pts. 9,197
  3. Avatar for dssb 83. dssb Lv 1 5 pts. 9,197
  4. Avatar for Mr_Jolty 84. Mr_Jolty Lv 1 4 pts. 9,171
  5. Avatar for Hiro Protagonist 85. Hiro Protagonist Lv 1 4 pts. 9,140
  6. Avatar for Mike Cassidy 86. Mike Cassidy Lv 1 4 pts. 9,118
  7. Avatar for dizzywings 87. dizzywings Lv 1 4 pts. 9,115
  8. Avatar for tomespen 88. tomespen Lv 1 4 pts. 9,113
  9. Avatar for fpc 89. fpc Lv 1 3 pts. 9,041
  10. Avatar for Neil9 90. Neil9 Lv 1 3 pts. 9,004

Comments