Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 5,503
  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 9,997
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 86 pts. 9,993
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 73 pts. 9,992
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 62 pts. 9,991
  5. Avatar for toshiue 5. toshiue Lv 1 52 pts. 9,991
  6. Avatar for mimi 6. mimi Lv 1 43 pts. 9,991
  7. Avatar for georg137 7. georg137 Lv 1 36 pts. 9,968
  8. Avatar for LociOiling 8. LociOiling Lv 1 30 pts. 9,955
  9. Avatar for smilingone 9. smilingone Lv 1 24 pts. 9,953
  10. Avatar for Deleted player 10. Deleted player 20 pts. 9,950

Comments