Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 5,503

  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 9,969
  2. Avatar for LociOiling 2. LociOiling Lv 1 98 pts. 9,964
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 95 pts. 9,958
  4. Avatar for matosfran 4. matosfran Lv 1 92 pts. 9,953
  5. Avatar for actiasluna 5. actiasluna Lv 1 89 pts. 9,947
  6. Avatar for Skippysk8s 6. Skippysk8s Lv 1 87 pts. 9,939
  7. Avatar for frood66 7. frood66 Lv 1 84 pts. 9,936
  8. Avatar for markm457 8. markm457 Lv 1 82 pts. 9,930
  9. Avatar for mimi 9. mimi Lv 1 79 pts. 9,911
  10. Avatar for ZeroLeak7 10. ZeroLeak7 Lv 1 77 pts. 9,911

Comments