Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 5,503

  1. Avatar for AeonFluff 131. AeonFluff Lv 1 1 pt. 7,963
  2. Avatar for jebbiek 132. jebbiek Lv 1 1 pt. 7,951
  3. Avatar for wuhongzei 133. wuhongzei Lv 1 1 pt. 7,945
  4. Avatar for Pibeagles 134. Pibeagles Lv 1 1 pt. 7,911
  5. Avatar for frostschutz 135. frostschutz Lv 1 1 pt. 7,892
  6. Avatar for Inkedhands 136. Inkedhands Lv 1 1 pt. 7,880
  7. Avatar for tela 137. tela Lv 1 1 pt. 7,877
  8. Avatar for trentis1 138. trentis1 Lv 1 1 pt. 7,828
  9. Avatar for metafolder 139. metafolder Lv 1 1 pt. 7,826
  10. Avatar for arlettelh97 140. arlettelh97 Lv 1 1 pt. 7,808

Comments