Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 5,503
  1. Avatar for Caleb_Y 151. Caleb_Y Lv 1 1 pt. 7,365
  2. Avatar for parsnip 152. parsnip Lv 1 1 pt. 7,358
  3. Avatar for nemesis21 153. nemesis21 Lv 1 1 pt. 7,350
  4. Avatar for Husain.Sarah 154. Husain.Sarah Lv 1 1 pt. 7,319
  5. Avatar for Pasnos 155. Pasnos Lv 1 1 pt. 7,305
  6. Avatar for Donald_H 156. Donald_H Lv 1 1 pt. 7,268
  7. Avatar for doctaven 157. doctaven Lv 1 1 pt. 7,256
  8. Avatar for Ilya Petrovich 158. Ilya Petrovich Lv 1 1 pt. 7,232
  9. Avatar for Meghan_SegretiE 159. Meghan_SegretiE Lv 1 1 pt. 7,222
  10. Avatar for Adnan_K 160. Adnan_K Lv 1 1 pt. 7,199

Comments