Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 5,503

  1. Avatar for Bletchley Park 21. Bletchley Park Lv 1 55 pts. 9,825
  2. Avatar for guineapig 22. guineapig Lv 1 53 pts. 9,809
  3. Avatar for jausmh 23. jausmh Lv 1 51 pts. 9,807
  4. Avatar for nicobul 24. nicobul Lv 1 50 pts. 9,804
  5. Avatar for johnmitch 25. johnmitch Lv 1 48 pts. 9,799
  6. Avatar for Blipperman 26. Blipperman Lv 1 46 pts. 9,798
  7. Avatar for Timo van der Laan 27. Timo van der Laan Lv 1 45 pts. 9,788
  8. Avatar for smilingone 28. smilingone Lv 1 43 pts. 9,783
  9. Avatar for Deleted player 29. Deleted player pts. 9,767
  10. Avatar for jamiexq 30. jamiexq Lv 1 40 pts. 9,745

Comments