Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 5,503
  1. Avatar for kabubi 41. kabubi Lv 1 27 pts. 9,687
  2. Avatar for tarimo 42. tarimo Lv 1 26 pts. 9,683
  3. Avatar for anthion 43. anthion Lv 1 25 pts. 9,681
  4. Avatar for WBarme1234 44. WBarme1234 Lv 1 24 pts. 9,677
  5. Avatar for Crossed Sticks 45. Crossed Sticks Lv 1 24 pts. 9,671
  6. Avatar for katling 46. katling Lv 1 23 pts. 9,663
  7. Avatar for SaraL 47. SaraL Lv 1 22 pts. 9,662
  8. Avatar for isaksson 48. isaksson Lv 1 21 pts. 9,652
  9. Avatar for diamonddays 49. diamonddays Lv 1 20 pts. 9,649
  10. Avatar for phi16 50. phi16 Lv 1 19 pts. 9,626

Comments