Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 5,503
  1. Avatar for pfirth 81. pfirth Lv 1 5 pts. 9,222
  2. Avatar for bcre8tvv 82. bcre8tvv Lv 1 5 pts. 9,197
  3. Avatar for dssb 83. dssb Lv 1 5 pts. 9,197
  4. Avatar for Mr_Jolty 84. Mr_Jolty Lv 1 4 pts. 9,171
  5. Avatar for Hiro Protagonist 85. Hiro Protagonist Lv 1 4 pts. 9,140
  6. Avatar for Mike Cassidy 86. Mike Cassidy Lv 1 4 pts. 9,118
  7. Avatar for dizzywings 87. dizzywings Lv 1 4 pts. 9,115
  8. Avatar for tomespen 88. tomespen Lv 1 4 pts. 9,113
  9. Avatar for fpc 89. fpc Lv 1 3 pts. 9,041
  10. Avatar for Neil9 90. Neil9 Lv 1 3 pts. 9,004

Comments