Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Contenders 100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 78 pts. 9,993
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,964
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,947
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,936
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 9,936
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,804
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,788
  9. Avatar for Kotocycle 9. Kotocycle 8 pts. 9,694
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,596

  1. Avatar for kabubi 41. kabubi Lv 1 27 pts. 9,687
  2. Avatar for tarimo 42. tarimo Lv 1 26 pts. 9,683
  3. Avatar for anthion 43. anthion Lv 1 25 pts. 9,681
  4. Avatar for WBarme1234 44. WBarme1234 Lv 1 24 pts. 9,677
  5. Avatar for Crossed Sticks 45. Crossed Sticks Lv 1 24 pts. 9,671
  6. Avatar for katling 46. katling Lv 1 23 pts. 9,663
  7. Avatar for SaraL 47. SaraL Lv 1 22 pts. 9,662
  8. Avatar for isaksson 48. isaksson Lv 1 21 pts. 9,652
  9. Avatar for diamonddays 49. diamonddays Lv 1 20 pts. 9,649
  10. Avatar for phi16 50. phi16 Lv 1 19 pts. 9,626

Comments